Recombinant Human MYOT Protein

Recombinant Human MYOT Protein
SKU
ASBPP-4248-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBF9

Gene Name: MYOT

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Leu101

End Site: Arg230

Coverage: 0.26

Isoelectric Point: 8.5

Core Sequence: LPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAKPIPRTPDHEIQGSKEALIQDLERKLKCKDTLLHNGNQRLTYEEKMARRLLGPQNAAAVFQAQDDSGAQDSQQHNSEHARLQVPTSQVRSR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 65%, Pig - 91%, Cynomolgus monkey - 97%

Alternative gene names: TTID

Alternative protein names: Myotilin; 57 kDa cytoskeletal protein; Myofibrillar titin-like Ig domains protein; Titin immunoglobulin domain protein

Protein name: myotilin

Full length: 498 amino acids

Entry name: MYOTI_HUMAN
More Information
SKU ASBPP-4248-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4248-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9499
Product information (PDF)
×
MSDS (PDF)
×