Note: Dry Ice fees will be extra-charged
Uniprot: Q86VE0
Gene Name: MYPOP
Expression System: Escherichia coli
Molecular Weight: 20.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 90%
Start Site: Glu11
End Site: Glu180
Coverage: 0.43
Isoelectric Point: 9.5
Core Sequence: ETTRLRKPRFSFEENQILIREVRAHYPQLYGAQSRRVSVAERRRVWDGIAAKINGITSWKRTGQEVQKRWNDFKRRTKEKLARVPHSTQGAGPAAEDAFSAEEETIFAILGPGVAAPGAGAGAEEPPAAPSSQPPPPSACPQRYVLSEDRREDRRADTSAHSKAGSSSPE
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 29%, Pig - 93%, Cynomolgus monkey - 26%
Alternative gene names: P42POP
Alternative protein names: Myb-related transcription factor; partner of profilin; Myb-related protein p42POP; Partner of profilin
Protein name: Myb related transcription factor, partner of profilin
Full length: 399 amino acids
Entry name: MYPOP_HUMAN
Product panel: DNA binding & Chromatin
English
Deutsch
