Recombinant Human NDUFA2 Protein

Recombinant Human NDUFA2 Protein
SKU
ASBPP-4006-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43678

Gene Name: NDUFA2

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Met1

End Site: Ala99

Coverage: 1.00

Isoelectric Point: 10

Core Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 96%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; Complex I-B8; CI-B8; NADH-ubiquinone oxidoreductase B8 subunit

Protein name: NADH:ubiquinone oxidoreductase subunit A2

Full length: 99 amino acids

Entry name: NDUA2_HUMAN
More Information
SKU ASBPP-4006-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4006-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4695
Product information (PDF)
×
MSDS (PDF)
×