Recombinant Human NDUFS6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75380

Gene Name: NDUFS6

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Gly29

End Site: His124

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: GVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 84%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6; mitochondrial; Complex I-13kD-A; CI-13kD-A; NADH-ubiquinone oxidoreductase 13 kDa-A subunit

Protein name: NADH:ubiquinone oxidoreductase subunit S6

Full length: 124 amino acids

Entry name: NDUS6_HUMAN

• SKU: ASBPP-4009-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4009-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 4726