Recombinant Human NEIL2 Protein

Recombinant Human NEIL2 Protein
SKU
ASBPP-4028-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q969S2

Gene Name: NEIL2

Expression System: Escherichia coli

Molecular Weight: 38 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Met1

End Site: Ser332

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Pig - 73%, Cynomolgus monkey - 92%

Alternative gene names: /

Alternative protein names: Endonuclease 8-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; Endonuclease VIII-like 2; Nei homolog 2; NEH2; Nei-like protein 2

Protein name: nei like DNA glycosylase 2

Full length: 332 amino acids

Entry name: NEIL2_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-4028-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4028-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 252969
Product information (PDF)
×
MSDS (PDF)
×