Recombinant Human NEIL3 Protein

Recombinant Human NEIL3 Protein
SKU
ASBPP-3726-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TAT5

Gene Name: NEIL3

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Thr401

End Site: Gln540

Coverage: 0.24

Isoelectric Point: 9

Core Sequence: TLERKTKQNQILDEEFQNSPPASVCLNDIQHPSKKTTNDITQPSSKVNISPTISSESKLFSPAHKKPKTAQYSSPELKSCNPGYSNSELQINMTDGPRTLNPDSPRCSKHNRLCILRVVGKDGENKGRQFYACPLPREAQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Pig - 65%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: Endonuclease 8-like 3; DNA glycosylase FPG2; DNA glycosylase/AP lyase Neil3; Endonuclease VIII-like 3; Nei-like protein 3

Protein name: nei like DNA glycosylase 3

Full length: 605 amino acids

Entry name: NEIL3_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-3726-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3726-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 55247
Product information (PDF)
×
MSDS (PDF)
×