Recombinant Human NEUROD6 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96NK8

Gene Name: NEUROD6

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Val11

End Site: Arg80

Coverage: 0.26

Isoelectric Point: 7.5

Core Sequence: VMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDENGLPRRRGLR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ATOH2; BHLHA2

Alternative protein names: Neurogenic differentiation factor 6; NeuroD6; Class A basic helix-loop-helix protein 2; bHLHa2; Protein atonal homolog 2

Protein name: neuronal differentiation 6

Full length: 337 amino acids

Entry name: NDF6_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4049-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4049-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 63974