Recombinant Human NFAT5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94916

Gene Name: NFAT5

Expression System: Escherichia coli

Molecular Weight: 32.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gly271

End Site: Thr540

Coverage: 0.18

Isoelectric Point: 8.5

Core Sequence: GQYPVKSEGKELKIVVQPETQHRARYLTEGSRGSVKDRTQQGFPTVKLEGHNEPVVLQVFVGNDSGRVKPHGFYQACRVTGRNTTPCKEVDIEGTTVIEVGLDPSNNMTLAVDCVGILKLRNADVEARIGIAGSKKKSTRARLVFRVNIMRKDGSTLTLQTPSSPILCTQPAGVPEILKKSLHSCSVKGEEEVFLIGKNFLKGTKVIFQENVSDENSWKSEAEIDMELFHQNHLIVKVPPYHDQHITLPVSVGIYVVTNAGRSHDVQPFT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0827; TONEBP

Alternative protein names: Nuclear factor of activated T-cells 5; NF-AT5; T-cell transcription factor NFAT5; Tonicity-responsive enhancer-binding protein; TonE-binding protein; TonEBP

Protein name: nuclear factor of activated T cells 5

Full length: 1531 amino acids

Entry name: NFAT5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4337-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4337-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10725