Recombinant Human NR2C2AP Protein

Recombinant Human NR2C2AP Protein
SKU
ASBPP-3249-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86WQ0

Gene Name: NR2C2AP

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Phe31

End Site: Ala120

Coverage: 0.69

Isoelectric Point: 5.5

Core Sequence: FDQDEETCWNSDQGPSQWVTLEFPQLIRVSQLQIQFQGGFSSRRGCLEGSQGTQALHKIVDFYPEDNNSLQTFPIPAAEVDRLKVTFEDA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 89%, Cynomolgus monkey - 95%

Alternative gene names: TRA16

Alternative protein names: Nuclear receptor 2C2-associated protein; TR4 orphan receptor-associated 16 kDa protein

Protein name: nuclear receptor 2C2 associated protein

Full length: 139 amino acids

Entry name: NR2CA_HUMAN
More Information
SKU ASBPP-3249-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3249-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 126382
Product information (PDF)
×
MSDS (PDF)
×