Note: Dry Ice fees will be extra-charged
Uniprot: P01111
Gene Name: NRAS
Expression System: Escherichia coli
Molecular Weight: 22 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Met1
End Site: Cys186
Coverage: 1.00
Isoelectric Point: 6
Core Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPC
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: HRAS1
Alternative protein names: GTPase NRas; Transforming protein N-Ras
Protein name: NRAS proto-oncogene, GTPase
Full length: 189 amino acids
Entry name: RASN_HUMAN
Product panel: Enzyme