Recombinant Human NSA2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O95478

Gene Name: NSA2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Met61

End Site: Thr130

Coverage: 0.31

Isoelectric Point: 11

Core Sequence: MKKTIKMHEKRNTKQKNDEKTPQGAVPAYLLDREGQSRAKVLSNMIKQKRKEKAGKWEVPLPKVRAQGET

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: TINP1

Alternative protein names: Ribosome biogenesis protein NSA2 homolog; Hairy cell leukemia protein 1; TGF-beta-inducible nuclear protein 1

Protein name: NSA2 ribosome biogenesis factor

Full length: 260 amino acids

Entry name: NSA2_HUMAN

• SKU: ASBPP-10482-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10482-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 10412