Recombinant Human OLFML3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRN5

Gene Name: OLFML3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu31

End Site: Asp130

Coverage: 0.27

Isoelectric Point: 5

Core Sequence: ERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNEKYD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 97%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Olfactomedin-like protein 3; HNOEL-iso; hOLF44

Protein name: olfactomedin like 3

Full length: 406 amino acids

Entry name: OLFL3_HUMAN

• SKU: ASBPP-3113-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3113-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56944