Recombinant Human P3H1 Protein

Recombinant Human P3H1 Protein
SKU
ASBPP-3242-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q32P28

Gene Name: P3H1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp391

End Site: Tyr500

Coverage: 0.16

Isoelectric Point: 4.5

Core Sequence: DSWTPEEVIPKRLQEKQKSERETAVRISQEIGNLMKEIETLVEEKTKESLDVSRLTREGGPLLYEGISLTMNSKLLNGSQRVVMDGVISDHECQELQRLTNVAATSGDGY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: GROS1; LEPRE1

Alternative protein names: Prolyl 3-hydroxylase 1; Growth suppressor 1; Leucine- and proline-enriched proteoglycan 1; Leprecan-1

Protein name: prolyl 3-hydroxylase 1

Full length: 736 amino acids

Entry name: P3H1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3242-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3242-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64175
Product information (PDF)
×
MSDS (PDF)
×