Recombinant Human PADI1 Protein

Recombinant Human PADI1 Protein
SKU
ASBPP-4188-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9ULC6

Gene Name: PADI1

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Lys331

End Site: Leu620

Coverage: 0.44

Isoelectric Point: 7.5

Core Sequence: KANCKLTICPQVENRNDRWIQDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTVGGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFVPTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVQSLL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 88%, Cynomolgus monkey - 97%

Alternative gene names: PAD1; PDI1

Alternative protein names: Protein-arginine deiminase type-1; Peptidylarginine deiminase I; Protein-arginine deiminase type I

Protein name: peptidyl arginine deiminase 1

Full length: 663 amino acids

Entry name: PADI1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4188-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4188-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 29943
Product information (PDF)
×
MSDS (PDF)
×