Recombinant Human PAGE4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O60829

Gene Name: PAGE4

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Met1

End Site: Pro102

Coverage: 1.00

Isoelectric Point: 5

Core Sequence: MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQP

Homologies: Highest protein sequence identity to the following orthologs: Pig - 63%, Cynomolgus monkey - 92%

Alternative gene names: GAGEC1

Alternative protein names: P antigen family member 4; PAGE-4; G antigen family C member 1; PAGE-1

Protein name: PAGE family member 4

Full length: 102 amino acids

Entry name: PAGE4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-4328-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4328-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 9506