Recombinant Human PALS2 Protein

Recombinant Human PALS2 Protein
SKU
ASBPP-413-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NZW5

Gene Name: PALS2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Leu11

End Site: Ser110

Coverage: 0.21

Isoelectric Point: 4.5

Core Sequence: LPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 68%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: MPP6; VAM1

Alternative protein names: Protein PALS2; MAGUK p55 subfamily member 6; Membrane protein; palmitoylated 6; Veli-associated MAGUK 1; VAM-1

Protein name: protein associated with LIN7 2, MAGUK p55 family member

Full length: 540 amino acids

Entry name: PALS2_HUMAN
More Information
SKU ASBPP-413-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-413-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51678
Product information (PDF)
×
MSDS (PDF)
×