Recombinant Human PASD1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8IV76

Gene Name: PASD1

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Start Site: Lys381

End Site: Glu560

Coverage: 0.23

Isoelectric Point: 10.5

Core Sequence: KEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVVIPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSLKNTGELQEPCVAFNQQQLVQQEQHLKEQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKKKKLQERKKWQGQMLQKEPEE

Homologies: Highest protein sequence identity to the following orthologs: Cynomolgus monkey - 90%

Alternative gene names: /

Alternative protein names: Circadian clock protein PASD1; Cancer/testis antigen 63; CT63; OX-TES-1; PAS domain-containing protein 1

Protein name: PAS domain containing repressor 1

Full length: 773 amino acids

Entry name: PASD1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10446-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10446-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 139135