Recombinant Human PBX4 Protein

Recombinant Human PBX4 Protein
SKU
ASBPP-3241-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYU1

Gene Name: PBX4

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu241

End Site: Ser310

Coverage: 0.21

Isoelectric Point: 8.5

Core Sequence: EAKEELARKGGLTISQVSNWFGNKRIRYKKNMGKFQEEATIYTGKTAVDTTEVGVPGNHASCLSTPSSGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Pig - 82%, Cynomolgus monkey - 94%

Alternative gene names: /

Alternative protein names: Pre-B-cell leukemia transcription factor 4; Homeobox protein PBX4

Protein name: PBX homeobox 4

Full length: 374 amino acids

Entry name: PBX4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3241-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3241-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 80714
Product information (PDF)
×
MSDS (PDF)
×