Recombinant Human PCIF1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H4Z3

Gene Name: PCIF1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Val101

End Site: Glu200

Coverage: 0.15

Isoelectric Point: 6.5

Core Sequence: VETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: C20orf67; CAPAM; PPP1R121

Alternative protein names: mRNA; 2'-O-methyladenosine-N(6)-)-methyltransferase; Cap-specific adenosine methyltransferase; CAPAM; hCAPAM; Phosphorylated CTD-interacting factor 1; hPCIF1; Protein phosphatase 1 regulatory subunit 121

Protein name: phosphorylated CTD interacting factor 1

Full length: 704 amino acids

Entry name: CAPAM_HUMAN

Product panel: Enzyme

• SKU: ASBPP-10469-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10469-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 63935