Recombinant Human PCIF1 Protein

Recombinant Human PCIF1 Protein
SKU
ASBPP-10469-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H4Z3

Gene Name: PCIF1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Val101

End Site: Glu200

Coverage: 0.15

Isoelectric Point: 6.5

Core Sequence: VETPPAENKPRKRQLSEEQPSGNGVKKPKIEIPVTPTGQSVPSSPSIPGTPTLKMWGTSPEDKQQAALLRPTEVYWDLDIQTNAVIKHRGPSEVLPPHPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: C20orf67; CAPAM; PPP1R121

Alternative protein names: mRNA; 2'-O-methyladenosine-N(6)-)-methyltransferase; Cap-specific adenosine methyltransferase; CAPAM; hCAPAM; Phosphorylated CTD-interacting factor 1; hPCIF1; Protein phosphatase 1 regulatory subunit 121

Protein name: phosphorylated CTD interacting factor 1

Full length: 704 amino acids

Entry name: CAPAM_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-10469-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10469-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 63935
Product information (PDF)
×
MSDS (PDF)
×