Recombinant Human PCMT1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P22061

Gene Name: PCMT1

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Met1

End Site: Lys227

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWSRWK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protein-L-isoaspartate(D-aspartate) O-methyltransferase; PIMT; L-isoaspartyl protein carboxyl methyltransferase; Protein L-isoaspartyl/D-aspartyl methyltransferase; Protein-beta-aspartate methyltransferase

Protein name: protein-L-isoaspartate (D-aspartate) O-methyltransferase

Full length: 227 amino acids

Entry name: PIMT_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3868-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3868-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5110