Note: Dry Ice fees will be extra-charged
Uniprot: P12004
Gene Name: PCNA
Expression System: Escherichia coli
Molecular Weight: 30 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Met1
End Site: Ser261
Coverage: 1.00
Isoelectric Point: 4.5
Core Sequence: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: /
Alternative protein names: Proliferating cell nuclear antigen; PCNA; Cyclin
Protein name: proliferating cell nuclear antigen
Full length: 261 amino acids
Entry name: PCNA_HUMAN
Product panel: Autoimmune Disease,IHC Pathology,DNA binding & Chromatin