Recombinant Human PCNX3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H6A9

Gene Name: PCNX3

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Pro201

End Site: Ala470

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: PGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPLLKGSLSQELSKSFLTLTQPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDSCFSGTDRETLSSFKSEKTNSTHLDSPPGGPAPEGSDTDPPSEAELPASPDAGVPSDDTLRSFDTVIGAGTPPGLAEPLLVVRPKDLALLRPSKRQPPLRRHSPPGRAPRRPLLEGGGFFEDEDTSEGSELSPASSLRSQRRYSTDSSSSTSCYSPESSRGAAGGPRKRRA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: PCNXL3

Alternative protein names: Pecanex-like protein 3; Pecanex homolog protein 3

Protein name: pecanex 3

Full length: 2034 amino acids

Entry name: PCX3_HUMAN

• SKU: ASBPP-3817-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3817-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 399909