Recombinant Human PDCD5 Protein

Recombinant Human PDCD5 Protein
SKU
ASBPP-4084-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14737

Gene Name: PDCD5

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Met1

End Site: Tyr125

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: TFAR19

Alternative protein names: Programmed cell death protein 5; TF-1 cell apoptosis-related protein 19; Protein TFAR19

Protein name: programmed cell death 5

Full length: 125 amino acids

Entry name: PDCD5_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4084-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4084-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 9141
Product information (PDF)
×
MSDS (PDF)
×