Note: Dry Ice fees will be extra-charged
Uniprot: O76074
Gene Name: PDE5A
Expression System: Escherichia coli
Molecular Weight: 39 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Gln541
End Site: Gln860
Coverage: 0.37
Isoelectric Point: 7
Core Sequence: QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAEQQ
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 99%, Cynomolgus monkey - 100%
Alternative gene names: PDE5
Alternative protein names: cGMP-specific 3'; 5'-cyclic phosphodiesterase; cGMP-binding cGMP-specific phosphodiesterase; CGB-PDE
Protein name: phosphodiesterase 5A
Full length: 875 amino acids
Entry name: PDE5A_HUMAN
Product panel: Neurodegenerative Diseases Marker,Neuroscience Biomarkers,Enzyme
English
Deutsch
