Recombinant Human PDIA5 Protein

Recombinant Human PDIA5 Protein
SKU
ASBPP-4302-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q14554

Gene Name: PDIA5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu31

End Site: Ala150

Coverage: 0.24

Isoelectric Point: 9

Core Sequence: ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: PDIR

Alternative protein names: Protein disulfide-isomerase A5; Protein disulfide isomerase-related protein

Protein name: protein disulfide isomerase family A member 5

Full length: 519 amino acids

Entry name: PDIA5_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4302-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4302-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10954
Product information (PDF)
×
MSDS (PDF)
×