Recombinant Human PDXK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00764

Gene Name: PDXK

Expression System: Escherichia coli

Molecular Weight: 36 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Met1

End Site: Leu312

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 85%, Pig - 88%, Cynomolgus monkey - 96%

Alternative gene names: C21orf124; C21orf97; PKH; PNK

Alternative protein names: Pyridoxal kinase; Pyridoxine kinase

Protein name: pyridoxal kinase

Full length: 312 amino acids

Entry name: PDXK_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3823-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3823-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8566