Recombinant Human PGAM1 Protein

Recombinant Human PGAM1 Protein
SKU
ASBPP-4094-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P18669

Gene Name: PGAM1

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Lys254

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: PGAMA

Alternative protein names: Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B

Protein name: phosphoglycerate mutase 1

Full length: 254 amino acids

Entry name: PGAM1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4094-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4094-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5223
Product information (PDF)
×
MSDS (PDF)
×