Recombinant Human PGRMC2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O15173

Gene Name: PGRMC2

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu71

End Site: Asn220

Coverage: 0.70

Isoelectric Point: 6.5

Core Sequence: LWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: DG6; PMBP

Alternative protein names: Membrane-associated progesterone receptor component 2; Progesterone membrane-binding protein; Steroid receptor protein DG6

Protein name: progesterone receptor membrane component 2

Full length: 223 amino acids

Entry name: PGRC2_HUMAN

• SKU: ASBPP-3913-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3913-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10424