Recombinant Human PGRMC2 Protein

Recombinant Human PGRMC2 Protein
SKU
ASBPP-3913-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O15173

Gene Name: PGRMC2

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu71

End Site: Asn220

Coverage: 0.70

Isoelectric Point: 6.5

Core Sequence: LWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: DG6; PMBP

Alternative protein names: Membrane-associated progesterone receptor component 2; Progesterone membrane-binding protein; Steroid receptor protein DG6

Protein name: progesterone receptor membrane component 2

Full length: 223 amino acids

Entry name: PGRC2_HUMAN
More Information
SKU ASBPP-3913-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3913-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10424
Product information (PDF)
×
MSDS (PDF)
×