Recombinant Human PHF7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BWX1

Gene Name: PHF7

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Thr281

End Site: Ser380

Coverage: 0.28

Isoelectric Point: 7

Core Sequence: THRDCSSLRSNSKKWECEECSPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPESSRGRRSYSWRSKGVRITNSCKKS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 70%, Pig - 79%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: PHD finger protein 7; Testis development protein NYD-SP6

Protein name: PHD finger protein 7

Full length: 381 amino acids

Entry name: PHF7_HUMAN

Product panel: E3 Ligase

• SKU: ASBPP-10451-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10451-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51533