Recombinant Human PI3 Kinase p110 delta Protein

Recombinant Human PI3 Kinase p110 delta Protein
SKU
ASBPP-4318-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O00329

Gene Name: PIK3CD

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Asn291

End Site: Pro480

Coverage: 0.18

Isoelectric Point: 9

Core Sequence: NPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 49%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: Phosphatidylinositol 4; 5-bisphosphate 3-kinase catalytic subunit delta isoform; PI3-kinase subunit delta; PI3K-delta; PI3Kdelta; PtdIns-3-kinase subunit delta; Phosphatidylinositol 4; 5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PtdIns-3-kinase subunit p110-delta; p110delta

Protein name: phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta

Full length: 1044 amino acids

Entry name: PK3CD_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4318-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4318-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5293
Product information (PDF)
×
MSDS (PDF)
×