Recombinant Human POLE4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NR33

Gene Name: POLE4

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Thr11

End Site: Ala110

Coverage: 0.98

Isoelectric Point: 6

Core Sequence: TPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 40%, Pig - 94%

Alternative gene names: /

Alternative protein names: DNA polymerase epsilon subunit 4; DNA polymerase II subunit 4; DNA polymerase epsilon subunit p12

Protein name: DNA polymerase epsilon 4, accessory subunit

Full length: 117 amino acids

Entry name: DPOE4_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3760-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3760-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56655