Recombinant Human POLN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q7Z5Q5

Gene Name: POLN

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Asp11

End Site: Ser190

Coverage: 0.20

Isoelectric Point: 9.5

Core Sequence: DLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQLEDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQLSADQKQKSISSLTLSSCLIPQYNQEASVLQKKGHKRKHFLMENINNENKGSINLKRKHITYNNLSEKTSKQMALEEDTDDAEGYLNSGNS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Pig - 53%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: DNA polymerase nu

Protein name: DNA polymerase nu

Full length: 900 amino acids

Entry name: DPOLN_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-10470-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10470-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 353497