Recombinant Human POLR3H Protein

Recombinant Human POLR3H Protein
SKU
ASBPP-4047-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y535

Gene Name: POLR3H

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Asn204

Coverage: 1.00

Isoelectric Point: 4.5

Core Sequence: MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: KIAA1665; RPC8

Alternative protein names: DNA-directed RNA polymerase III subunit RPC8; RNA polymerase III subunit C8; DNA-directed RNA polymerase III subunit H; RNA polymerase III subunit 22.9 kDa subunit; RPC22.9

Protein name: RNA polymerase III subunit H

Full length: 204 amino acids

Entry name: RPC8_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4047-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4047-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 171568
Product information (PDF)
×
MSDS (PDF)
×