Recombinant Human POLR3K Protein

Recombinant Human POLR3K Protein
SKU
ASBPP-3363-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2Y1

Gene Name: POLR3K

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly11

End Site: Ala100

Coverage: 0.97

Isoelectric Point: 7.5

Core Sequence: GLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 55%, Pig - 98%, Cynomolgus monkey - 95%

Alternative gene names: RPC11

Alternative protein names: DNA-directed RNA polymerase III subunit RPC10; RNA polymerase III subunit C10; DNA-directed RNA polymerase III subunit K; RNA polymerase III 12.5 kDa subunit; RPC12.5; RNA polymerase III subunit C11; HsC11p; RPC11; hRPC11

Protein name: RNA polymerase III subunit K

Full length: 108 amino acids

Entry name: RPC10_HUMAN
More Information
SKU ASBPP-3363-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3363-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51728
Product information (PDF)
×
MSDS (PDF)
×