Recombinant Human POU3F3 Protein

Recombinant Human POU3F3 Protein
SKU
ASBPP-3248-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P20264

Gene Name: POU3F3

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: His281

End Site: Pro490

Coverage: 0.43

Isoelectric Point: 8.5

Core Sequence: HPPHPHHAQGPPHHGGGGGGAGPGLNSHDPHSDEDTPTSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITNLADSLQLEKEVVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 84%

Alternative gene names: BRN1; OTF8

Alternative protein names: POU domain; class 3; transcription factor 3; Brain-specific homeobox/POU domain protein 1; Brain-1; Brn-1; Octamer-binding protein 8; Oct-8; Octamer-binding transcription factor 8; OTF-8

Protein name: POU class 3 homeobox 3

Full length: 500 amino acids

Entry name: PO3F3_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3248-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3248-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5455
Product information (PDF)
×
MSDS (PDF)
×