Recombinant Human PPIC Protein

Recombinant Human PPIC Protein
SKU
ASBPP-3873-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P45877

Gene Name: PPIC

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Lys31

End Site: Ala210

Coverage: 0.89

Isoelectric Point: 8

Core Sequence: KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 72%, Pig - 95%, Cynomolgus monkey - 97%

Alternative gene names: CYPC

Alternative protein names: Peptidyl-prolyl cis-trans isomerase C; PPIase C; Cyclophilin C; Rotamase C

Protein name: peptidylprolyl isomerase C

Full length: 212 amino acids

Entry name: PPIC_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3873-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3873-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5480
Product information (PDF)
×
MSDS (PDF)
×