Recombinant Human PPIH Protein

Recombinant Human PPIH Protein
SKU
ASBPP-4117-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43447

Gene Name: PPIH

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Met177

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 57%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: CYP20; CYPH

Alternative protein names: Peptidyl-prolyl cis-trans isomerase H; PPIase H; Rotamase H; Small nuclear ribonucleoprotein particle-specific cyclophilin H; CypH; U-snRNP-associated cyclophilin SnuCyp-20; USA-CYP

Protein name: peptidylprolyl isomerase H

Full length: 177 amino acids

Entry name: PPIH_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4117-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4117-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10465
Product information (PDF)
×
MSDS (PDF)
×