Recombinant Human PPP1R11 Protein

Recombinant Human PPP1R11 Protein
SKU
ASBPP-4007-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O60927

Gene Name: PPP1R11

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Met1

End Site: His126

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: HCGV; TCTE5

Alternative protein names: E3 ubiquitin-protein ligase PPP1R11; Hemochromatosis candidate gene V protein; HCG V; Protein phosphatase 1 regulatory subunit 11; Protein phosphatase inhibitor 3

Protein name: protein phosphatase 1 regulatory inhibitor subunit 11

Full length: 126 amino acids

Entry name: PP1RB_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4007-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4007-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6992
Product information (PDF)
×
MSDS (PDF)
×