Recombinant Human PRM3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NNZ6

Gene Name: PRM3

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Gly11

End Site: Ala90

Coverage: 0.93

Isoelectric Point: 4.5

Core Sequence: GQSPGHSPGHSTGHGRGHESSMKKLMACVSQDNFSLSSAGEEEEEEEEEGEEEEKEELPVQGKLLLLEPERQEEGHKDNA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 63%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Protamine-3; Sperm protamine P3

Protein name: protamine 3

Full length: 103 amino acids

Entry name: PRM3_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10359-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10359-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 58531