Recombinant Human PRPS1 Protein

Recombinant Human PRPS1 Protein
SKU
ASBPP-4128-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P60891

Gene Name: PRPS1

Expression System: Escherichia coli

Molecular Weight: 36 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Leu318

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I

Protein name: phosphoribosyl pyrophosphate synthetase 1

Full length: 318 amino acids

Entry name: PRPS1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4128-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4128-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 5631
Product information (PDF)
×
MSDS (PDF)
×