Recombinant Human PRTN3 Protein

Recombinant Human PRTN3 Protein
SKU
ASBPP-3259-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P24158

Gene Name: PRTN3

Expression System: Escherichia coli

Molecular Weight: 36.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 69%

Start Site: Ile28

End Site: Arg248

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 69%, Rat - 39%, Pig - 73%, Cynomolgus monkey - 45%

Alternative gene names: MBN

Alternative protein names: Myeloblastin; AGP7; C-ANCA antigen; Leukocyte proteinase 3; PR-3; PR3; Neutrophil proteinase 4; NP-4; P29; Wegener autoantigen

Protein name: proteinase 3

Full length: 256 amino acids

Entry name: PRTN3_HUMAN

Product panel: Autoimmune Disease,Enzyme
More Information
SKU ASBPP-3259-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3259-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5657
Product information (PDF)
×
MSDS (PDF)
×