Recombinant Human PSMA6 Protein

Recombinant Human PSMA6 Protein
SKU
ASBPP-4129-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P60900

Gene Name: PSMA6

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Asp246

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: PROS27

Alternative protein names: Proteasome subunit alpha type-6; 27 kDa prosomal protein; PROS-27; p27K; Macropain iota chain; Multicatalytic endopeptidase complex iota chain; Proteasome iota chain

Protein name: proteasome 20S subunit alpha 6

Full length: 246 amino acids

Entry name: PSA6_HUMAN
More Information
SKU ASBPP-4129-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4129-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5687
Product information (PDF)
×
MSDS (PDF)
×