Recombinant Human PSMB1 Protein

Recombinant Human PSMB1 Protein
SKU
ASBPP-3937-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P20618

Gene Name: PSMB1

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Arg29

End Site: Asp241

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: PSC5

Alternative protein names: Proteasome subunit beta type-1; Macropain subunit C5; Multicatalytic endopeptidase complex subunit C5; Proteasome component C5; Proteasome gamma chain

Protein name: proteasome 20S subunit beta 1

Full length: 241 amino acids

Entry name: PSB1_HUMAN
More Information
SKU ASBPP-3937-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3937-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5689
Product information (PDF)
×
MSDS (PDF)
×