Recombinant Human PSMB4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P28070

Gene Name: PSMB4

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Thr46

End Site: Glu264

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 99%

Alternative gene names: PROS26

Alternative protein names: Proteasome subunit beta type-4; 26 kDa prosomal protein; HsBPROS26; PROS-26; Macropain beta chain; Multicatalytic endopeptidase complex beta chain; Proteasome beta chain; Proteasome chain 3; HsN3

Protein name: proteasome 20S subunit beta 4

Full length: 264 amino acids

Entry name: PSB4_HUMAN

• SKU: ASBPP-3870-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3870-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5692