Recombinant Human PSMB7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q99436

Gene Name: PSMB7

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Thr44

End Site: Ser277

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: Z

Alternative protein names: Proteasome subunit beta type-7; Macropain chain Z; Multicatalytic endopeptidase complex chain Z; Proteasome subunit Z

Protein name: proteasome 20S subunit beta 7

Full length: 277 amino acids

Entry name: PSB7_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3895-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3895-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 5695