Recombinant Human PTGR1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14914

Gene Name: PTGR1

Expression System: Escherichia coli

Molecular Weight: 37 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Met1

End Site: Ala329

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Rat - 82%, Pig - 85%, Cynomolgus monkey - 92%

Alternative gene names: LTB4DH

Alternative protein names: Prostaglandin reductase 1; PRG-1; 15-oxoprostaglandin 13-reductase; Dithiolethione-inducible gene 1 protein; D3T-inducible gene 1 protein; DIG-1; Leukotriene B4 12-hydroxydehydrogenase; NAD(P)H-dependent alkenal/one oxidoreductase

Protein name: prostaglandin reductase 1

Full length: 329 amino acids

Entry name: PTGR1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3887-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3887-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 22949