Recombinant Human PTP4A2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q12974

Gene Name: PTP4A2

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Cys164

Coverage: 1.00

Isoelectric Point: 8.5

Core Sequence: MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%

Alternative gene names: PRL2; PTPCAAX2

Alternative protein names: Protein tyrosine phosphatase type IVA 2; HU-PP-1; OV-1; PTP(CAAXII); Protein-tyrosine phosphatase 4a2; Protein-tyrosine phosphatase of regenerating liver 2; PRL-2

Protein name: protein tyrosine phosphatase 4A2

Full length: 167 amino acids

Entry name: TP4A2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3963-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3963-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 8073