Recombinant Human SHP2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q06124

Gene Name: PTPN11

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Arg111

End Site: Thr240

Coverage: 0.24

Isoelectric Point: 7

Core Sequence: RWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: PTP2C; SHPTP2

Alternative protein names: Tyrosine-protein phosphatase non-receptor type 11; Protein-tyrosine phosphatase 1D; PTP-1D; Protein-tyrosine phosphatase 2C; PTP-2C; SH-PTP2; SHP-2; Shp2; SH-PTP3

Protein name: protein tyrosine phosphatase non-receptor type 11

Full length: 593 amino acids

Entry name: PTN11_HUMAN

Product panel: Enzyme

• SKU: ASBPP-10498-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10498-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5781